Airsport Photo Library client comments
"David Wootton's photographic experience and intimate knowledge of the paragliding scene enabled us to find two outstanding contributors for our forthcoming programme, Extreme Animals. With their help we enjoyed a very successful shoot filming Himalayan Griffon Vultures in India from tandem paragliding rigs and we are very excited by the sequence which resulted."
"David was also able to offer suggestions on Indian filming locations, removing the need for what might have been a very costly recce trip."
Dr Simon Bell BBC Bristol Production -
'Steve Leonard's Extreme Animals'.


more client comments
hang glidingparaglidingskydivingglidingmicrolightingballooningothers
contact detailsaerial stunt coordinationclient comments